SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3HK53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3HK53
Domain Number 1 Region: 1124-1300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.23e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-573
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-24
Family Pleckstrin-homology domain (PH domain) 0.0000115
Further Details:      
 
Domain Number 4 Region: 878-1039
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.93e-17
Family SAM (sterile alpha motif) domain 0.0000256
Further Details:      
 
Domain Number 6 Region: 585-685
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000257
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 7 Region: 1434-1567
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000761
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 8 Region: 1016-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.000000402
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3HK53
Sequence length 1700
Comment (tr|A0A2I3HK53|A0A2I3HK53_NOMLE) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSNLEP00000044023} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ARAP2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSSSVQTSSPPQL
ETVTKNLEDNDASVERSQYPQSDNKLSPPKGDFPTAEEPHLNLGSLNDSLFGSENIKIES
LFTKKTLDHTIEEQQTEKVKLITENLSELPNADSECLSSVGCSTSGTNSGNGTNGLLEGS
PPSSFFKFQGEMIVNDLYVPSSPILAPMRNRSKLVSRPSRSFLLRHRPVPEIPGSTKGVS
GSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQEE
ALKGEATTATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE
CFQSLRRKNSKASKSRTQKALTLDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAVSTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHVD
SPVEKRKSFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLY
QAPAAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQIQEVQGDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKFIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTGDTIKHCSDRSTLGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLQDGFLFLYKDYLNVHTFLFVWVLTIVFYATVSHLSWK
SLPVVYKMHGKHLCCDSSQTQTEWMTSIFIAQHENDIWPPAGKERKRSITKNPKIGGLPL
IPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDLSLKERASVVAHCLEHKDDKLR
NRTRKHRSFNCLEDTEPVAPHGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELN
VVLQRSRTLPKELQDEQILK
Download sequence
Identical sequences A0A2I3HK53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]