SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3HZ07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3HZ07
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.59e-16
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 260-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000943
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3HZ07
Sequence length 374
Comment (tr|A0A2I3HZ07|A0A2I3HZ07_NOMLE) Transmembrane protein with EGF like and two follistatin like domains 2 {ECO:0000313|Ensembl:ENSNLEP00000048843} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TMEFF2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTATTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences A0A2I3HZ07
ENSNLEP00000008261 XP_003253919.1.23891 ENSNLEP00000008261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]