SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3LFI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I3LFI3
Domain Number - Region: 259-279
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0628
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3LFI3
Sequence length 526
Comment (tr|A0A2I3LFI3|A0A2I3LFI3_PAPAN) Zinc finger CCCH-type containing 12D {ECO:0000313|Ensembl:ENSPANP00000022244} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ZC3H12D OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MEHSSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEYPAAPRLVP
RGSCGALDSAQRGPGTALEEDFGALASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW
FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD
RYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGP
SLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPG
AGAEEQLPPRAPGGPAGARAAPREPVAHSLPLARGSPDLVALQGSFSRLAFSDDPGPLGP
PPPGHACGLTPRLGGPDWVSAGCQVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR
DLHGDLLSSRRLPDDPWARLPRSDRFPGRSAWAEPAWGDGATGGLSGYAAEDEGEARARA
RIALYSVFPRDQVDRVMAAFPALSDLARLILLVQRSQSAGAPLGKP
Download sequence
Identical sequences A0A2I3LFI3
ENSPANP00000011490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]