SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3LQL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3LQL6
Domain Number 1 Region: 62-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 270-384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000113
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 473-510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 183-220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 229-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 434-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3LQL6
Sequence length 662
Comment (tr|A0A2I3LQL6|A0A2I3LQL6_PAPAN) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSPANP00000025727} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=LRP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALGKKVAGDTWLFLESVGETPA
ACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSL
DWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKL
GQASCQADEFRCDNGKCLPGPWQCNAVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSG
ARSTRCLPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLH
CTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQG
RLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGSAGDQGCFSEPQRCDGW
WHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFH
CGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFK
LYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQYTPRKK
MGTPVRMMMMPTPQTIGSEMKLKTSRKAQKTKYATGMRRFTWGRGSRNTDGAGPPAVCTP
DP
Download sequence
Identical sequences A0A2I3LQL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]