SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3LX92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3LX92
Domain Number 1 Region: 292-552
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-57
Family YWTD domain 0.0000000173
Further Details:      
 
Domain Number 2 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 42-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 82-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 5 Region: 116-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 6 Region: 203-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 7 Region: 244-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 8 Region: 563-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000178
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3LX92
Sequence length 697
Comment (tr|A0A2I3LX92|A0A2I3LX92_PAPAN) LDL receptor related protein 8 {ECO:0000313|Ensembl:ENSPANP00000028081} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=LRP8 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGRPERGALRPLALLLLLLLLQLQHLAAAAADPLLGGQGPAKECEKDQFQCRNERCIPSV
WRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCT
KQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCVTSLGTCHGNEFQCGDGTCV
LAIKRCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQK
TCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGKSPSLIFTNRHEV
RRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLI
DEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRCTLFSRNLSEPRAIAVDPLQG
FMYWSDWGNQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSID
FSGGNRKMLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNP
HDIVIFHELKQPRAADACKLSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMK
RCYRDGNEDSKMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYR
KTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences A0A2I3LX92 A0A2K5UU88
XP_005543386.1.63531 XP_014995503.1.72884 ENSMMUP00000009999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]