SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3NB85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3NB85
Domain Number 1 Region: 231-521
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.43e-78
Family WD40-repeat 0.00000000183
Further Details:      
 
Domain Number 2 Region: 112-224
Classification Level Classification E-value
Superfamily F-box domain 6.15e-27
Family F-box domain 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3NB85
Sequence length 542
Comment (tr|A0A2I3NB85|A0A2I3NB85_PAPAN) F-box and WD repeat domain containing 11 {ECO:0000313|Ensembl:ENSPANP00000045240} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=FBXW11 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVS
RKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFI
TALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKG
LSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENS
KGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLV
GHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPA
STLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYI
SR
Download sequence
Identical sequences A0A287BCR0 A0A2I2UDS6 A0A2I3GE80 A0A2I3NB85 A0A2J8X7F1 A0A2K5F0B6 A0A2K5JRI2 A0A2K5KHS3 A0A2K5S0S3 A0A2K6C7F1 A0A2K6FB64 A0A2K6RBX8 A0A2K6SZQ7 F1PBF1 F7GX48 G1LXB0 G3QXZ2 G7P6W4 H9FRX5 Q9UKB1
ENSP00000265094 ENSAMEP00000011713 HR4708 ENSCAFP00000024854 ENSCJAP00000035869 gi|48928050|ref|NP_036432.2| 9606.ENSP00000265094 ENSNLEP00000000414 ENSGGOP00000007712 ENSGGOP00000007712 ENSCJAP00000035867 ENSP00000377391 ENSAMEP00000011709 ENSP00000265094 NP_036432.2.87134 NP_036432.2.92137 XP_002696296.1.76553 XP_002744586.2.60252 XP_003273287.1.23891 XP_003781992.1.62490 XP_003936202.1.74449 XP_003981323.1.62641 XP_004043039.1.27298 XP_004371254.1.4749 XP_004392059.1.74151 XP_004665059.1.11716 XP_004679271.1.23501 XP_005376389.1.28644 XP_005558577.1.63531 XP_006053761.1.26621 XP_006765450.1.95426 XP_007465595.1.90284 XP_007937958.1.48129 XP_008013485.1.81039 XP_008145834.1.99482 XP_008253607.1.1745 XP_010590791.1.64505 XP_011738365.1.29376 XP_011803177.1.43180 XP_011906394.1.92194 XP_012009417.1.54773 XP_012316555.1.9421 XP_012389288.1.21590 XP_012620942.1.48125 XP_014586010.1.31192 XP_014706348.1.49734 XP_014956717.1.66739 XP_014996884.1.72884 XP_016000576.1.101085 XP_016066712.1.3490 XP_017403167.1.71028 XP_017496240.1.32401 XP_017920981.1.57651 XP_019491504.1.44202 XP_019596763.1.88060 XP_019663913.1.58354 XP_019801442.1.83887 XP_019838368.1.53367 XP_020932776.1.46622 XP_612428.5.59421 XP_866627.1.84170 ENSCAFP00000024856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]