SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3RBH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RBH3
Domain Number 1 Region: 30-302
Classification Level Classification E-value
Superfamily L domain-like 1.83e-60
Family Ngr ectodomain-like 0.00000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RBH3
Sequence length 420
Comment (tr|A0A2I3RBH3|A0A2I3RBH3_PANTR) Reticulon 4 receptor like 2 {ECO:0000313|Ensembl:ENSPTRP00000061784} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0030724 OC=Catarrhini; Hominidae; Pan.
Sequence
MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPP
STQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLR
SLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLAN
LSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLA
SLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLR
ALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQ
GGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL
Download sequence
Identical sequences A0A2I2ZDA6 A0A2I3RBH3
ENSGGOP00000009302 ENSGGOP00000009302 XP_004051210.1.27298 XP_016776390.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]