SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3RFB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RFB4
Domain Number 1 Region: 157-395
Classification Level Classification E-value
Superfamily RNI-like 2.35e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.000000000675
Further Details:      
 
Domain Number 2 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 3.53e-16
Family F-box domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RFB4
Sequence length 424
Comment (tr|A0A2I3RFB4|A0A2I3RFB4_PANTR) SKP2 isoform 1 {ECO:0000313|EMBL:PNI25644.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0044881 OC=Catarrhini; Hominidae; Pan.
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL
Download sequence
Identical sequences A0A024R069 A0A2I3RFB4 Q13309
ENSPTRP00000028804 ENSP00000274255 9606.ENSP00000274255 ENSPTRP00000028804 ENSP00000274255 gi|16306595|ref|NP_005974.2| NP_005974.2.87134 NP_005974.2.92137 XP_003806703.1.60992 XP_526948.2.37143 ENSP00000274255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]