SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3RH19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RH19
Domain Number 1 Region: 113-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-89
Family Protein kinases, catalytic subunit 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RH19
Sequence length 451
Comment (tr|A0A2I3RH19|A0A2I3RH19_PANTR) Cyclin dependent kinase 14 {ECO:0000313|Ensembl:ENSPTRP00000066768} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0033010 OC=Catarrhini; Hominidae; Pan.
Sequence
MHGYFGCNAAAEPGYSAFVGTPQICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQS
TFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKL
EKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHD
IIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLK
PQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGV
GCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKS
LRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTV
PNVRLQPEAGESMRAFGKNNSYDKSLSNSKH
Download sequence
Identical sequences A0A2I3RH19
ENSPTRP00000033167 ENSPTRP00000033167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]