SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3RIX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RIX8
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.47e-36
Family SCAN domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 211-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-21
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RIX8
Sequence length 272
Comment (tr|A0A2I3RIX8|A0A2I3RIX8_PANTR) Zinc finger protein 197 {ECO:0000313|Ensembl:ENSPTRP00000064622} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=ZNF197 OC=Catarrhini; Hominidae; Pan.
Sequence
MTRENLAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFQSILPGEIRTWVQLHRPGSGEEAVALVEEL
QKDLDGPAIQVPVLVKDQDTLQKAVSAPGTTLPPVLPGSHIAAEICPHPPTDLVAFNLQD
PQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLDTKYTRQSKIIGTRVA
Download sequence
Identical sequences A0A2I3RIX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]