SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3RLI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RLI8
Domain Number 1 Region: 279-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-43
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-16
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  A0A2I3RLI8
Domain Number - Region: 179-244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0115
Family Spectrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RLI8
Sequence length 452
Comment (tr|A0A2I3RLI8|A0A2I3RLI8_PANTR) TRIM49 isoform 1 {ECO:0000313|EMBL:PNI57186.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0022079 OC=Catarrhini; Hominidae; Pan.
Sequence
MNSGILQVFQRELICPMCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSAE
QINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIR
AEYQKMPAFHHEEEKQNLEMLKKKGKEIFHRLHLSKAKMAHRMEILRGMYEELNEMCHKP
DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANSDT
FLYEILRSMCIGCDHQDVPYFTATPRSFLAWGAQTFTSGKYYWEVHVGDSWNWAFGVCNM
YWKEKNQNEKIDGEEGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPSSRIGLFLDCEAKTV
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF
Download sequence
Identical sequences A0A2I3RLI8
9598.ENSPTRP00000040843 ENSPTRP00000040843 ENSPTRP00000040843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]