SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3RPT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RPT6
Domain Number 1 Region: 46-184,238-495
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 4.84e-110
Family Proton glutamate symport protein 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RPT6
Sequence length 574
Comment (tr|A0A2I3RPT6|A0A2I3RPT6_PANTR) Amino acid transporter {ECO:0000256|RuleBase:RU361216} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0005406 OC=Catarrhini; Hominidae; Pan.
Sequence
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Download sequence
Identical sequences A0A2I2ZRF1 A0A2I3RPT6 P43004
NP_004162.2.87134 NP_004162.2.92137 XP_003313030.1.37143 XP_004050990.1.27298 ENSP00000278379 gi|40254478|ref|NP_004162.2| ENSGGOP00000013900 ENSP00000278379 ENSGGOP00000013900 ENSP00000278379 ENSPTRP00000006085 9598.ENSPTRP00000006085 9606.ENSP00000278379 ENSPTRP00000006085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]