SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3S0V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3S0V2
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-81
Family Sec7 domain 0.00000000414
Further Details:      
 
Domain Number 2 Region: 260-380
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-35
Family Pleckstrin-homology domain (PH domain) 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3S0V2
Sequence length 397
Comment (tr|A0A2I3S0V2|A0A2I3S0V2_PANTR) Cytohesin 1 {ECO:0000313|Ensembl:ENSPTRP00000070624} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0040980 OC=Catarrhini; Hominidae; Pan.
Sequence
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPT
PEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences A0A2I3S0V2 A0A2J8Y1W9 A0A2K5TR87 I0FWE8
ENSP00000465665 NP_001248726.1.72884 NP_059430.2.87134 NP_059430.2.92137 XP_005585193.1.63531 XP_008011304.1.81039 XP_016788516.1.37143 ENSP00000465665 gi|110349763|ref|NP_059430.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]