SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3SIQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3SIQ4
Domain Number 1 Region: 24-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.36e-29
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 
Domain Number 2 Region: 205-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.22e-26
Family GAS2 domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3SIQ4
Sequence length 880
Comment (tr|A0A2I3SIQ4|A0A2I3SIQ4_PANTR) Growth arrest specific 2 like 2 {ECO:0000313|Ensembl:ENSPTRP00000076362} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0028734 OC=Catarrhini; Hominidae; Pan.
Sequence
MSQPAGGRRKPRTLGPPVCSIRPFKSSEQYLEAMKEDLAEWLRDLYGLDIDAANFLQVLE
TGLVLCRHANVVTDAALAFLAEAPAQAQKIPMPQVGVSYNGAAQPGTFQARDNVSNFIQW
CRKEMGIQEVLMFETEDLVLRKNVKNVVLCLLELGRRAWRFGVAAPTLVQLEEEIEEEVR
RELALPPPDPSPPAPPRRQPCHFRNLDQMVQNLVSHCTCPVQFSMVKVSEGKYRVGDSNT
LIFIRILRNHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHKPGSFLKPPAPPVQHEVRVQD
GPSQTQPTMTISRSQSPPPPVDWKTYTSSDRRLRPPTPSSPRPRRERGAGTGASREMAPF
LRCQERSLIPSWRQPTAGDSPPSPQSSSTQKGRDPQYTLSGKREERYPPELPRGRISTSW
VHEETDSWGTDAGNPTPQRLRAIEATTKGISARGPSPLPRSFGPAECLGLRLPLRDEAKG
AFFQFREPESVRSPTPVQGLTKIPIRLPPARPPTPGRSFPGATSGSPRTELGRDPIPLRA
VTVDLAGSTHGDCSVEVRQEDQQLDIQVMAEARESWDLGPQEHEGRYTPLPLGRNKEQAI
YCSLEEEILGNMKLLEVRSACPQGTRSGVIPRSGVYIPRLVGQWPEPGGPYDKVIQELAQ
GPPSLLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVP
PQGGQDCSASTVSASPEAPTPSPLDPNSDKAKVCLSKGRRTLRKPKRVPSIYKLKLRPRI
RPRRDHRPEKQPSRIPKPLAYVFLGPARQPPKDRLLRAVLGSKGGEASRVDGASVGEEEE
EGKEEKEPAAPLESSPQPPEGLQPHWLNQAPLPPEEESWV
Download sequence
Identical sequences A0A2I3SIQ4
9598.ENSPTRP00000015390 ENSPTRP00000015390 ENSPTRP00000015390 XP_001174066.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]