SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3SJH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3SJH8
Domain Number 1 Region: 318-395
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.74e-23
Family Intermediate filament protein, coiled coil region 0.0000878
Further Details:      
 
Domain Number 2 Region: 89-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000204
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3SJH8
Sequence length 543
Comment (tr|A0A2I3SJH8|A0A2I3SJH8_PANTR) Neurofilament light {ECO:0000313|Ensembl:ENSPTRP00000076638} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0013347 OC=Catarrhini; Hominidae; Pan.
Sequence
MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQY
AQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA
AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRT
TKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEE
KDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAK
KKD
Download sequence
Identical sequences A0A2I3SJH8 A0A2J8X4Z4 G3RNG2 P07196 Q5R408
ENSP00000482169 NP_006149.2.87134 NP_006149.2.92137 XP_003823612.1.60992 XP_004046845.1.27298 XP_519665.2.37143 NYSGRC-105990539 ENSPPYP00000020675 ENSGGOP00000001414 9606.ENSP00000221169 ENSPPYP00000020675 gi|105990539|ref|NP_006149.2| ENSGGOP00000017329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]