SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3SN54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3SN54
Domain Number 1 Region: 185-327
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-40
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-27
Family Second domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-21
Family First domain of FERM 0.00094
Further Details:      
 
Weak hits

Sequence:  A0A2I3SN54
Domain Number - Region: 485-510
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0889
Family Probable GTPase Der, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3SN54
Sequence length 714
Comment (tr|A0A2I3SN54|A0A2I3SN54_PANTR) FRMD7 isoform 2 {ECO:0000313|EMBL:PNI25744.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0044796 OC=Catarrhini; Hominidae; Pan.
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEIVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTAL
MVSHILQSELGDFHEETDRKHLAQTRYLPNQDCLEGKIMHFHQKHIGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGRKGRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYQNVNGVHASEPVLESRRRNSALEVTFATELEHSKPEADPTLLHQSQSSSSFTFIYMD
PVFNTEPDPNPDPRDIFSERSSLSSFQTSCKFSGNHMSISSGLTSKVRPAKQLTYTDVPY
IPCTGQQVGIMPPQVFFYVDKPPQVPRWSPIRAEERTSPDSHVEPTAMKPAERSPRNIRM
KSFQQDLQVLQEAIARTSGRSNINVGLEEEDPNLEDAFVCNIQEQTPKRSQSQSDMKTIS
FPFGSEFRPLGPCPALSHKADLFTDMFAEQELPAVLMDQSTAERYVASESSDSESEILKP
DYYALYGKEIRSPMARIRLSSGSLQLDEEDEDAYFNTPTAEDRTSLKSCNYFLA
Download sequence
Identical sequences A0A2I3SN54
ENSPTRP00000047262 ENSPTRP00000047262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]