SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3SQ46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3SQ46
Domain Number 1 Region: 619-678
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000196
Family R3H domain 0.0028
Further Details:      
 
Domain Number 2 Region: 352-431
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000331
Family Double-stranded RNA-binding domain (dsRBD) 0.0079
Further Details:      
 
Domain Number 3 Region: 455-532
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000038
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Weak hits

Sequence:  A0A2I3SQ46
Domain Number - Region: 206-291
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00579
Family Double-stranded RNA-binding domain (dsRBD) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3SQ46
Sequence length 705
Comment (tr|A0A2I3SQ46|A0A2I3SQ46_PANTR) NKRF isoform 3 {ECO:0000313|EMBL:PNI17520.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0050797 OC=Catarrhini; Hominidae; Pan.
Sequence
MGFMLPLIFRYSPRLMEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKK
QAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSF
SIQDGNSQYCDSSGFILTKDQPVTANMYFDSGNPAPSTTSQQANSQSTPEPSPSQTFPES
VVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIP
PADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRATELAVKLLQKRIEVRVVRR
KFKHTFGEDLVVCQIGMSSYEFPPALKPPEDLVVLGKDASGQPIFNASAKHWTNFVITEN
ANDAIGILNNSASFNKMSIEYKYEMMPNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEA
LKILQKTQPTYPSVKSSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMT
VEYVYERMTGLRWKCKVILESEVIAEAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKG
AVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTGGGLGKSGEGIREPISVKEQ
HKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGL
KSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN
Download sequence
Identical sequences A0A2I3SQ46
ENSPTRP00000038260 ENSP00000442308 ENSP00000360582 NP_001166958.1.87134 NP_001166958.1.92137 ENSPTRP00000038260 gi|291084505|ref|NP_001166958.1| ENSP00000442308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]