SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3STF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3STF1
Domain Number 1 Region: 31-193
Classification Level Classification E-value
Superfamily RUN domain-like 9.15e-46
Family RUN domain 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3STF1
Sequence length 456
Comment (tr|A0A2I3STF1|A0A2I3STF1_PANTR) RUNDC3B isoform 6 {ECO:0000313|EMBL:PNI46396.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0029096 OC=Catarrhini; Hominidae; Pan.
Sequence
MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSS
PEFNNFAAILEQILSHRLKGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSS
SRAKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAI
DFSFCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPP
FLMDENSWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLA
HKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYR
KHNKQWYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPSLLGLC
GSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS
Download sequence
Identical sequences A0A2I3STF1 A0A2J8WKB0
gi|197304744|ref|NP_001127877.1| ENSP00000378149 NP_001127877.1.87134 NP_001127877.1.92137 XP_001163673.1.37143 XP_003822771.1.60992 XP_018887177.1.27298 ENSP00000378149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]