SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3T4P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I3T4P0
Domain Number - Region: 128-209
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000334
Family Snake venom toxins 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3T4P0
Sequence length 210
Comment (tr|A0A2I3T4P0|A0A2I3T4P0_PANTR) Acrosomal vesicle protein 1 {ECO:0000313|Ensembl:ENSPTRP00000084199} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0015503 OC=Catarrhini; Hominidae; Pan.
Sequence
MNRFFLLMSLYLLGSARGTSGQPDELSGSIDHQTSVQQLPGEPAATEHAEGEHTVGEQPS
GEQPSGEHLSGEQPLSKLESGEQPSDEQPSGEHASGEQPSGEQASGEQPSGEHASGEQAS
GAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGC
ENMCPTMNLFSHGTRMQIICCRNQSFCNKI
Download sequence
Identical sequences A0A2I3T4P0
ENSPTRP00000007598 ENSPTRP00000007598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]