SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3TFG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TFG2
Domain Number 1 Region: 34-108
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 6.15e-30
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TFG2
Sequence length 110
Comment (tr|A0A2I3TFG2|A0A2I3TFG2_PANTR) TSC22D3 isoform 13 {ECO:0000313|EMBL:PNI17020.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0051262 OC=Catarrhini; Hominidae; Pan.
Sequence
MAFQPPYSSSLFRKRDNASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELV
EKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences A0A2I2ZX64 A0A2I3TFG2 A0A2J8VAS1 Q5JRJ0
ENSGGOP00000023574 ENSP00000361457 ENSP00000361457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]