SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3TKV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TKV3
Domain Number 1 Region: 323-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-63
Family SPRY domain 0.00000588
Further Details:      
 
Domain Number 2 Region: 33-145
Classification Level Classification E-value
Superfamily Immunoglobulin 4.91e-23
Family V set domains (antibody variable domain-like) 0.00025
Further Details:      
 
Domain Number 3 Region: 161-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000003
Family C1 set domains (antibody constant domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TKV3
Sequence length 530
Comment (tr|A0A2I3TKV3|A0A2I3TKV3_PANTR) Butyrophilin, subfamily 2, member A1 {ECO:0000313|EMBL:JAA06899.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0045425 OC=Catarrhini; Hominidae; Pan.
Sequence
MESAAALHFSRPASLLLLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLHCHLSPEK
NAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITA
QENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTV
WRDPYGGVVPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIP
ESFMPSVSPCAVALPIIVVILMIPIAICIYWINKLQKEKKILSGEKEFERETREIAVKEL
EKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRH
LEESVPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIP
QNGFWTLEMHKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPR
SAFSVPVRPFFRLGCEDSPIFICPALAGANGVTVPEEGLTLHRVGTHQSL
Download sequence
Identical sequences A0A2I3TKV3
XP_003311119.1.37143 ENSPTRP00000030423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]