SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3TQM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TQM6
Domain Number 1 Region: 15-215
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-26
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 2 Region: 674-792
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000132
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TQM6
Sequence length 1349
Comment (tr|A0A2I3TQM6|A0A2I3TQM6_PANTR) LMO7 isoform 1 {ECO:0000313|EMBL:PNI81352.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0004552 OC=Catarrhini; Hominidae; Pan.
Sequence
MKKIRICHIFTFYSWMSYDVLFQRTELGALEIWRQLICAHVCICVGWLYLRDRVCSKKDI
ILRTEQNSGRTILIKAVTEKNFETKDFRASLENGVLLCDLINKLKPGVIKKINRLSTPIA
GLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRVKNVLITLYWLGRKA
QSNPYYNGPHLNLKAFENLLGQALTKALEDSSFLKRSGRDSGYGDIWCPERGEFLAPPRH
HKREDSFESLDSLGSRSLTSCSSDITLRGGREGFESDTDSEFTFKMQDYNKDDMSYRRIS
AVEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEADGTFSRLFQ
KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTS
DLQKKKEEREEIEKQALEKSERSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGK
RPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
ASLSSLRSRSTQMESTRVSASLPRSYQKTDTVRLTSVVTPRPFGSQTRGISSLPRSYTMD
DAWKYNGDVEDIKRTPNNVVSTPAPSPDASQLASSLSSQKEVAATEEDVTRLPSPTSPFS
SLSQDQAATSKATLSSTSGLDLMSESGEGEISPQREVSRSQDQFSDMRISINQTPGKSLD
FGFTIKWDIPGIFVASVEAGSPAEFSQLQVDDEIIAINNTKFSYNDSKEWEEAMAKAQET
GHLVMDVRRYGKAGSPETKWIDATSGIYNSEKSSNLSVTTDFSESLQSSNIESKEINGIH
DESNAFESKASESISLKNLKRRSQFFEQGSSDSVVPDLPVPTISAPSRWVWDQEEERKRQ
ERWQKEQDRLLQEKYQREQEKLREEWQRAKQEAERENSKYLDEELMVLSSNSMSLTTREP
SLATWEATWSEGSKSSDREGTRAGEEERRQPQEEVVREDQGKKPQDQLVIQRERKWEQQL
QEEQEQKRLQAEAEEQKRPAEEQKRQAEIERETSVRIYQYRRPVDSYDIPKTEEASSGFL
PGDRNKSRSTTELDDYSTNKNGNNKYLDQIGNTTSSQRRSKKEQVPSGAELERQQILQEM
RKRTPLHNDNSWIRQRSASVNKEPVSLPGIMRRGESLDNLDSPRSNSWRQPPWLNQPTGF
YASSSVQDFSRPPPQLVSTSNRAYMRNPSSSVPPPSAGSVKTSTTGVATTQSPTPRSHSP
SASQSGSQLRNRSVSGKRICSYCNNILGKGAAMIIESLGLCYHLHCFKCVACECDLGGSS
SGAEVRIRNHQLYCNDCYLRFKSGRPTAM
Download sequence
Identical sequences A0A2I3TQM6
ENSPTRP00000010086 XP_001139492.1.37143 ENSPTRP00000010086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]