SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3TXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I3TXI6
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000314
Family Rhomboid-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TXI6
Sequence length 223
Comment (tr|A0A2I3TXI6|A0A2I3TXI6_PANTR) Rhomboid domain containing 2 {ECO:0000313|Ensembl:ENSPTRP00000093940} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0052199 OC=Catarrhini; Hominidae; Pan.
Sequence
MLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLSIGLAYGLTYC
YSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQSCHP
HLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPASGLCYVQNHFGPNPTSSSVYP
ASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVPMP
Download sequence
Identical sequences A0A2I3TXI6
ENSP00000314144 ENSP00000391232 ENSP00000458798 ENSP00000461474 ENSP00000314144 ENSP00000391232 gi|94818879|ref|NP_001035547.1| NP_001035547.1.87134 NP_001035547.1.92137 XP_003318573.1.37143 XP_005250568.1.92137 XP_008959315.1.60992 XP_016814285.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]