SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4BD54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4BD54
Domain Number 1 Region: 454-588
Classification Level Classification E-value
Superfamily TIMP-like 1.57e-25
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 229-325
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 407-461
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 4 Region: 343-402
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000525
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 147-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000222
Family Ovomucoid domain III-like 0.032
Further Details:      
 
Domain Number 6 Region: 54-102
Classification Level Classification E-value
Superfamily Elafin-like 0.000000732
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I4BD54
Sequence length 591
Comment (tr|A0A2I4BD54|A0A2I4BD54_9TELE) WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 {ECO:0000313|RefSeq:XP_013865672.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=wfikkn1 OC=Austrofundulus.
Sequence
MCEIPLRFLEDKHSVWHSAICPNKPLTGWTHACFLMLLICDCLXFSLCATVAGSRVEHEG
FCPNKLNSNLWVDAQSTCERECSVDEDCADFEKCCTNVCGLSSCVAARFSDGTPAQPDGK
GGGTGEEDPASKATCEGFICSQQGASCDIWDGQLVCKCQDRCEKEPNFTCASDGLTYFNR
CYMDAEACIRGVILTVIPCRFYLAGPHTSPVPQDTTANPTPTSSQEDPMPPTLYSNPHHQ
SIYVGGTVNFHCDVIGIPRPDVTWEKQSDRRERLVMKPDQMYGNVVITNIGQLVVYNAQV
WDTGIYTCIARNSAGVLRADYPLSVIRRAEDDFSEDPEMPMGRPFSPADCLAEVDLRVCS
GDRHVDWFYDSKLGSCMTYNNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCKT
WEARWAWNSLMKQCQAFVYGGCQGNDNNFHTKKECEANCPQPKRRPCRTCRMRGKMMPSL
CRSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFSTKHLEVTITKIDWSCPCP
NITIEENPLLVMGMVQDGMAFIQSDSYVKAITERRLKXLREAINKKSCEAS
Download sequence
Identical sequences A0A2I4BD54
XP_013865672.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]