SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4BNF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4BNF5
Domain Number 1 Region: 541-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.00079
Further Details:      
 
Domain Number 2 Region: 56-103
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000654
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 119-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000884
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 494-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000207
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4BNF5
Sequence length 587
Comment (tr|A0A2I4BNF5|A0A2I4BNF5_9TELE) complement component C8 beta chain {ECO:0000313|RefSeq:XP_013869275.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=c8b OC=Austrofundulus.
Sequence
MFSVMRQARGVLSPSCRLSLALSLVLLSGAAQTAASSEPSVREARSVGNQLMVQPVDCVL
SEWSRWSRCDTCTKKRYRYAKLDQPSQFGGEPCSFHSRQEEACDVPARYTCDNIPLCEGF
LCTQTGRCVHRTLQCNGEDDCGDMSDEAGCKKASKPCRVEAEEFWGIENLAKGINVLNSD
LEGVVLDNRYYGGSCLPQYIQDVPFRKPFNLQQYAFQTKGSYDFTLNAFSTYSEYMHYSS
TEHTSQTSFSIGFGVPGVFNFGFNFSESKYRKSVQKTRRASGKSYSFLRAKAELQLAQYM
LKSEDLVLHPEFLQRLRSLPQVYIYGEYSQIYRDYGTHYVTEATLGGDYEYTIILNKEKL
EKSDYSLEAYKSCVQAGLNVGANIYGVYVSVGAKGGSCDGLLNEMGEDTQNGSMVEDFVA
VVRGGSSETISALMSKTLPTPELMRLWGEGVRFNPDIIRLTAKPLYELVTSRDFTQDAIL
KRNLKKGLSEYLAETSSCRCAPCHNNGQAVLKGTRCECLCPSGYTGRSCEITQRPTDLAT
DGSWSCWGAWSSCSGGKMTRSRQCNNPAPSSAGLPCIGLEQDSTECF
Download sequence
Identical sequences A0A2I4BNF5
XP_013869275.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]