SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4CZR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4CZR5
Domain Number 1 Region: 877-1154
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-85
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000565
Further Details:      
 
Domain Number 2 Region: 1147-1452
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000112
Further Details:      
 
Domain Number 3 Region: 25-185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-37
Family MAM domain 0.00000844
Further Details:      
 
Domain Number 4 Region: 387-591
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-26
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 283-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000041
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I4CZR5
Sequence length 1455
Comment (tr|A0A2I4CZR5|A0A2I4CZR5_9TELE) receptor-type tyrosine-protein phosphatase U-like {ECO:0000313|RefSeq:XP_013885496.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=LOC106533644 OC=Austrofundulus.
Sequence
MRPAALLLLLLAARTCADSTERVTAGCTFDEDSDSGLCEYNQGQEDDFDWQLIRTYSWPH
PTTDLLPGSFMMVNSSQHMGAQRAQLHLLPLSENDTHCIQFSYFLYSRDGHSPGALQVYI
RVNGGPKGSAVWNISGSQGHQWHQVELAVSTFWPSEYQVIFEATVSDDRQGYIALDDTVL
LNYPCYKVAHFSRLGDVEVNAGQNASFQCVATGKVSETEPFLLERRNGAVLNTSSLSWLS
HKRLMATFQVEAQRGEQDLYRCITLSPRGAAVSNFGELIVRVPPTPIAPPQLLRAGPTYL
IIQLNTNSIVGDGPVIRREIQYRASQSTWTETHIVGSLTYKVWHLEPDTEYQISVLLTRP
GEGGTGAPGPPLVSRTKCAEPMRALRGLTATEIQPRQLALQWEPLGYNLTRCHTYSLSLC
YRYSTPAGSSGGNKATVRECLSVDRNTSHFTXRDLPPFRTVHVRLALSNLEGKKESREVT
FQTEEDIPGGIAPESLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPG
PRRTVSKLRNETYHMFSGLYPGTTYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDIP
SPLSESESTITVLLRPALGRGAPVSAYQVVVVEDDGSRQVRRRELGTVDCFPSPNSHNEA
QLKGSPHYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLVYFQATSNFRGET
RINCIRIARKAACKDSKTALEVSQHTEDMGLILGACAGGLVVLILLLGAIVIIVKKGRDF
YSYPYYPRKKVAINKAAMSYRQEKSRKLSSLDCSMTEQSTLQQDERMAHSFMDAHSCNTR
NEQRSSVNESSSLLGGSPQRHCQRKSSPYHTGQLHPAVRVADLLQHINQMKTSEGYGFKQ
EYESFFNGWDVTKKKDKTKGKHDSLLSHDRHRVKLHSLLADPSSEYVNANYIDIRINREG
YQRSNHFIATQGPNQEMIYDFWRMVWQENCFSIVMLTKLVEIGRIKCCKYWPDDTELYGD
IKITQLKTETLAEYTVRTFAMERRGYPAKHEVSQFHFTSWPEHGVPYHSTGLLAFLRRVK
ASTPPDAGPVVVHCSMGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTE
EQYVFIHDAILEACLCGETAIPVSEFSLTYKEMLKIDSQSNTSQLREEFQTLNSVTPHLD
VEECSISLMPRNREKNRSMDVLPPDRSLAFLITAEGESSNYVNAALADSFLRPAAFVVTP
HPLPSTTTDFWRLVYDYGCTSVVMLNQLNQSNSAWPCLQYWPEPGLQQFGPMTVELLSRT
ADDDIIIRLFRIQNITRLQEGQLVVRHFQFLRWSPYRDVPDSKKAFLSLLAQVYNWQREC
GEGRTAVHCLNGGGRSGTFCACTMILEMIRHHSVVDVFFAAKTLRNSKPNMVETMEQYRF
CYELAQEYLDCLEVR
Download sequence
Identical sequences A0A2I4CZR5
XP_013885496.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]