SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4E065 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4E065
Domain Number 1 Region: 241-385
Classification Level Classification E-value
Superfamily ApaG-like 1.02e-24
Family ApaG-like 0.00043
Further Details:      
 
Domain Number 2 Region: 31-85
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000209
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4E065
Sequence length 385
Comment (tr|A0A2I4E065|A0A2I4E065_9ROSI) F-box protein SKIP16-like isoform X3 {ECO:0000313|RefSeq:XP_018812789.1} KW=Complete proteome OX=51240 OS=Juglans regia (English walnut). GN=LOC108985081 OC=Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans.
Sequence
MHTIAFASYQIWREAFSMYPWLLVIRVKRCWGRLNNWLDINFPEAKATLRTGVSEADIQE
FERILKVKLPLPTRILYRFCDGQEFTSKSIVSAHGSLLGLIGGYSFYHHIINVYLLPLNE
VISNTKVILRHPSFSSRSKYIVVAASSTYVEKFFFLNCTTGQLHVGTKNLPIDGEMLPCV
PNALINSVHDFNDDQQQDAMLLWLEEHGRRLENGVIKLHEEGGIRSISLFPEEPPFCSTA
VTNGVKVRASAVFIPELTDLQIDDLQIDHQNYAFSYSIRMSLLPEGCIIHGVPFSSCQLH
RRHWIICANDHIVSDVNAEAVIGKFPLLLPGAKEFVYESCASLPTSLGSIEGSFTFVPGR
LTDPKGAPFEAEVARVPLQLPDYIF
Download sequence
Identical sequences A0A2I4E065
XP_018812789.1.44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]