SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6LLK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6LLK6
Domain Number 1 Region: 25-123
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-31
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 198-307
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000202
Family Calsequestrin 0.058
Further Details:      
 
Domain Number 3 Region: 434-558
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000366
Family PDI-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J6LLK6
Sequence length 567
Comment (tr|A0A2J6LLK6|A0A2J6LLK6_LACSA) Uncharacterized protein {ECO:0000313|EMBL:PLY88221.1} KW=Complete proteome OX=4236 OS=Lactuca sativa (Garden lettuce). GN=LSAT_8X100801 OC=Cichorioideae; Cichorieae; Lactucinae; Lactuca.
Sequence
MKNTWTISMIFFTCSLLLYASVESKSLDPYKVLGVEKDASSRQIQKAFHKLSLQYHPDKN
KNKGAQEKFEEINNAYEILSDEEKRKNYDMYGDSRGNPGFDGGAHGGHTYFRSGGGPGHG
GGFTFSPDEWQTMGGQSGGSKSYSFSFGGSGGDSPFGFDVGDVFSNFFGGGMGGGMGGSG
SQFGGFGGGARSSPKNMVSINSQLYKKEVIEKGVTWLLLSYTPSMKGTQHFESIIEEIGN
SLKGALEVGSVNCEVESSFCKELGIRPKNKPRVYIYSYKSIEIGSLIEYTGDGTLKDLKS
FVQDHFPKFSKRLTLTEFETKFNTIESLPKLILLSTKKDTPVIWRALSGMFRKRFIFYDT
QVKDVSDPLVENLGVDKLPAVIGLLSNGEMKVLKSGIHVKDMKSTIKELGLLFDGFEKKN
KKLGGSNSDNEGIPLLRATNFDLICGEKTPVCVIGVFKSAKGREKLHKILSSVSQKSLLR
RQNPASGPRDSVSYALLDASNQSSFLYAFDKSGFKSLDMLLVAYKSRKSKFSAFTGDVTF
EEVERFVGSVLNGDVQFSKTRQKPTLK
Download sequence
Identical sequences A0A2J6LLK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]