SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6N345 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6N345
Domain Number 1 Region: 87-187
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.29e-25
Family Ribosomal protein S3 C-terminal domain 0.00059
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 8.63e-22
Family Prokaryotic type KH domain (KH-domain type II) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J6N345
Sequence length 251
Comment (tr|A0A2J6N345|A0A2J6N345_9CREN) 30S ribosomal protein S3 {ECO:0000313|EMBL:PMB75729.1} KW=Complete proteome OX=683846 OS=Fervidicoccus fontis. GN=C0177_00895 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MVNIKRYFIEKNMSVVKVDEYLAKQFYRAGYAGVDVYRTPLGTRVVIRAERPAFIIGRRG
QTIKTLSNVFENYFGLENPQITVMPVENPDLNARVVAFRLAVSLERGFHFRKLAFAALRR
IMAAGAAGAEIIISGKITSERARYEKFRAGKIYKTGEQATYIVDKAVAHALLKPGIYGVK
VIIVKPERTKDSIIIKSPEEIGINKESTAKEKEQKEEMGEQISTQAQESSSQQVLQPQEE
STEEEGEGETQ
Download sequence
Identical sequences A0A2J6N345 I0A0J7
gi|385805558|ref|YP_005841956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]