SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6N3D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J6N3D9
Domain Number - Region: 51-83
Classification Level Classification E-value
Superfamily Prefoldin 0.00222
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J6N3D9
Sequence length 83
Comment (tr|A0A2J6N3D9|A0A2J6N3D9_9CREN) Uncharacterized protein {ECO:0000313|EMBL:PMB75756.1} KW=Complete proteome OX=683846 OS=Fervidicoccus fontis. GN=C0177_01045 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MAWGKRFGTYPGNGPWSNLPPWERPGWKYGRGWCWQGYGRVAWPYSESPLSKEEEIRYLE
EQKKYLEDSLKEIDERLKVLKNQ
Download sequence
Identical sequences A0A2J6N3D9 I0A0N0
gi|385805591|ref|YP_005841989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]