SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6N7U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6N7U2
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000029
Family RecA protein-like (ATPase-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J6N7U2
Sequence length 188
Comment (tr|A0A2J6N7U2|A0A2J6N7U2_9CREN) Methylmalonyl Co-A mutase-associated GTPase MeaB {ECO:0000313|EMBL:PMB77408.1} KW=Complete proteome OX=683846 OS=Fervidicoccus fontis. GN=C0177_03240 OC=Fervidicoccaceae; Fervidicoccus.
Sequence
MKENRESVRIFLTGHPGIGKTTLVLKLASILTLEKVKFAGFATPEKRGKSGREGFELIIF
PSNEVHELASKSIEKGYKMKLGSYYVNENMGAIILKIINEYLNDDSFKFFIGDEVGPMEL
MIPGIREGILKLLKAEEKSMLMSFHINLKQKDPEIYDLISKGDVYVLSTENRNQILNDII
NKIRRKII
Download sequence
Identical sequences A0A2J6N7U2 I0A2K2
gi|385806263|ref|YP_005842661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]