SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J6PAL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6PAL8
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Phage tail protein-like 6.8e-48
Family STM4215-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J6PAL8
Sequence length 161
Comment (tr|A0A2J6PAL8|A0A2J6PAL8_HAEPA) Uncharacterized protein {ECO:0000313|EMBL:PMC56841.1} KW=Complete proteome OX=729 OS=Haemophilus parainfluenzae. GN=CJ219_03690 OC=Pasteurellaceae; Haemophilus.
Sequence
MSATLPILDSIRKRIEDKTEQFSIELFPDDLEHYNLTDEFGAVLVQYAGSKFESIDSVDI
IQQRRVVMIALTVIARSQHDDHGAVDMLDKIRLAVVGFKPTNCTACSLVSEEFAGEADGL
WQYQLMVQTETWQVELRELENLPKFTTALYRRAGNSKPNQP
Download sequence
Identical sequences A0A2J6PAL8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]