SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7PPZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7PPZ6
Domain Number 1 Region: 557-626
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00071
Further Details:      
 
Domain Number 2 Region: 632-725
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 477-554
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00096
Further Details:      
 
Domain Number 4 Region: 893-968
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00022
Further Details:      
 
Domain Number 5 Region: 1039-1116
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00011
Further Details:      
 
Domain Number 6 Region: 109-194
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00011
Further Details:      
 
Domain Number 7 Region: 323-409
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000912
Further Details:      
 
Domain Number 8 Region: 972-1046
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00015
Further Details:      
 
Domain Number 9 Region: 195-273
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 10 Region: 412-483
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000127
Family Eukaryotic type KH-domain (KH-domain type I) 0.00037
Further Details:      
 
Domain Number 11 Region: 274-341
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 12 Region: 721-798
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 13 Region: 794-892
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J7PPZ6
Sequence length 1196
Comment (tr|A0A2J7PPZ6|A0A2J7PPZ6_9NEOP) Vigilin {ECO:0000313|EMBL:PNF18401.1} KW=Complete proteome OX=105785 OS=Cryptotermes secundus. GN=B7P43_G11013 OC=Termitoidae; Kalotermitidae; Cryptotermitinae; Cryptotermes.
Sequence
MQQAVMEEEAAYDPPTLKYDDAFPALPESVTSTSPTVNQLGQWNNKMRIGSSVVTQVFRV
PFEERKFDHSDKFGEGESVRTCSMIMKETGAHIEIASSKDMSLTFLVTGKQNAVLDARRK
ILTHFQTQASMCISIPKEHHRFILGKNGNKLKDLEKTTATKISVPNMADGSDKITITGTK
EGIEKAVHEIRVTSDEQSKQAYERISVPKMYHPFICGAHNEKVTALMNETGVRINIPPLS
VQKDEIIITGEKEGVMTAKERILSIYQEMEKKCTIVSVEVPKSQHKHVIGHRGNTIAEIL
QTTGVSVEMPPNDSSKGTITLRGPHDKLGLALNMVYEKAHSVITATVDAPNWIHKYIIGR
KGANIRRFTQDLTKVHVEFTDKEDRIKIEGPPEEVERAQASLEDMARDLISKLTFVEMTV
DPKYYKHIIGKNGANVNRMKDELGVVINIAENDSSNLIRIEGIKAGVEKAKQELEDMVHK
LENEKERDIIIDHRFYRTIIGSKGDNIREIREMFNQVQITFPGPGENRDVVKIRGPKEDV
DKCYKHLMKIVKELNESSYETEVPIYKQFHKFVIGKGGANIRKIRDETQTKIDLPAEGEK
SDVITITGKKENVQEAKERILKIQNELVTIRGPKEDVMKAVQQLQELATERQLSSYSAEV
RAKQQHHKYLIGKNGANIKKIRENTGARIVFPTDKDEDKEAITIIGKQEAVERAKAELEA
IIKEIDNIVESDMSVEPRHHRHFVARRGEVLNRISDECDHVMISFPRPGVQSDRVVLKGA
KDCIEMAKRRIQEIVADLESMVTIECIIPQKHHRTVMGAKGCKVQGITYEFCVNIKFPDR
DAQEEYHNHQDEGQQPNGNVEEHEPVRVCDVIRITGKRENCEAAQRALLDLVPVTVEVNV
PFDFHRSIIGQKGRDVRELMEKYDVHIVLSPADQRLDIIKISGTPACVERAKEAIEERCK
ELEAERQDRILKSFELKIEVDPEYHPKIIGRKGAVISKIRSDHGVQVNFLKKGDPEEHII
TITGYEQNTLAARDDIMKIVNEWNNMVKEEVHIDARVHSRLIGARGRNIHKIMEQYSVDI
KFPRSTDTDPNIVTVIGAEENVLDARDCLLNLEEEYMQDVNDAEMRESYRPSFSRGEDGG
SSLGHGGGVTGFVVKGGPWEQRAPDTASTSEFPSFGGGGEDPQCVPSPSGAWGPRR
Download sequence
Identical sequences A0A2J7PPZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]