SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7RCH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7RCH1
Domain Number 1 Region: 335-620
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.64e-67
Family Eukaryotic proteases 0.00062
Further Details:      
 
Domain Number 2 Region: 35-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 73-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 161-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 124-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 248-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000473
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J7RCH1
Sequence length 621
Comment (tr|A0A2J7RCH1|A0A2J7RCH1_9NEOP) Modular serine protease {ECO:0000313|EMBL:PNF38537.1} KW=Complete proteome OX=105785 OS=Cryptotermes secundus. GN=B7P43_G04009 OC=Termitoidae; Kalotermitidae; Cryptotermitinae; Cryptotermes.
Sequence
MGGMLCYLCGILLIISYSAHGVKVESKIHPYLRHRRQTCSTSKFQCASGQCIDITALCDG
SKDCDDGSDETVRQCSNMRCPQFAFQCSYGACVDAIAKCNGVTDCADGSDEQLPSCAKKP
GTSICKSSEFQCKSGKCIDDTLVCDGIKDCRDDGSDETFEQCRNFRCSPLSFRCSYGACI
DPDYRCDGRAQCADSSDEDPVLCGNENKGTCKLPDKPKDGKYKILNCKETDISPFCLQVP
DTVAPDWTILEYRCDAGYNLIGAASVPCVEGKWSYSHPTCVQVSCPPLESSSVNIKCTYK
GSSVLCGKDMAPGTVASLECKVSYQLTFEPGYNKVSCLQNGKWDKPLFTCTPVCGKRNPK
GRPFISNGVEAKVGEFPWHVGIYRYSANGTLQQVCGGSLVNPSVVLTAAHCFWNEAYGRT
MDKDNFRIAAGKYYRDWNIKDSEMQERQLSEIIVHENYRGRKLHFTSDIALVKLNVSVEL
TWAVLPVCVDWKDEYERFQLSNGSLGVTVGWGYTQNNEPSTELLTTNLPYVDFQTCWNTI
PETFQSYVTRDKFCAGYQNGTSVCPGDSGGGIAFERDQKYYLRGIVSVGLVPEGDAKCFT
DQYTAFTKVSDFLTWMEDNIR
Download sequence
Identical sequences A0A2J7RCH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]