SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZWC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZWC7
Domain Number 1 Region: 197-270
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.01e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 
Domain Number 2 Region: 103-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 283-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.01e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 459-495
Classification Level Classification E-value
Superfamily WW domain 0.00000000193
Family WW domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZWC7
Sequence length 497
Comment (tr|A0A2J7ZWC7|A0A2J7ZWC7_9CHLO) Far upstream element-binding protein 3 {ECO:0000313|EMBL:PNH04564.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_009259 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MADQDTAAPTLHAGDVAAGDDAHLEGLNPSVTEAILGAGRNRALELASLFAAQAGQHSGD
KRKLDDGSEGPELKRPAGDVLGILSEAPAVLPSSSFLSGDAALATETVMCPSDKVGRVIG
RAGATIRDLEASTSTRIQVDHKAPGDKPVTISGMREDVDRAKRTVQDLIAGVSGVGADAG
AGGGGGGSSAIPSAGEVQKTLECPQGIVGRVIGRGGETIRTLQQASGAHILVNQDFPDGV
PRQITVSGSQDAVERASNMVAELIAGDHANTQAVIQRFGLGSTEVLECPKVMVGRIIGKG
GETIKDLQKRFNASIQIDQASTPCKVTITGPSSTLSAARRAIEELVRSTSSAPPVGGKLK
KLTLCFNASVRAGSLPAGLRPAPGPYNAPYGQPYNPPAYGGGYSNFPVPAPSYGAPAGYP
PYSGYSPYPAAASHYGAYSAYGPGGAPTDPYANASAYQGASQPPSASVWQPLQDDQGRTY
FYNSSTGQSQWEKPADL
Download sequence
Identical sequences A0A2J7ZWC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]