SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J7ZYZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7ZYZ0
Domain Number 1 Region: 972-1122
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000294
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 464-639
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000342
Family Ankyrin repeat 0.0069
Further Details:      
 
Domain Number 3 Region: 278-376
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000458
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number 4 Region: 57-137
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000889
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J7ZYZ0
Sequence length 1212
Comment (tr|A0A2J7ZYZ0|A0A2J7ZYZ0_9CHLO) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:PNH05489.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_008240 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MCRAVLGGNVAVMEVLHARGVLMGEETVRRAAAAGYLPGVAWLVEMLGAGTALTTHVFAA
AAQAGSMEPLAWLRERGCPWDATVFAAAAEEGSEEQLEWLAEQGCPMGDDGAPYAHAAAN
GELAILRCLRRLSCPWSLDGGIFTRAVGFSHTTRIRQHVERGLCLLLEQGCPVDWDEAEL
AAAGNEQQLAAATSDPSRIWLPELVQRFAVSLTSNEVACALRLVNKATAAQFSTPQHTTI
RLSQPVPHHAFARRWGGPNATRTLAQQQRLELPRLTARSGSIANLEVLLAWDDLPPILDP
DVFRAAAAAGQLDVCVWLRQQGCPWCVGYLAAAAEGGHRAVCEWLLANGYPEMEDQSKGT
AAAARGGHVDLMDWLLLRAGGAHVAVSDSLAAAAEGCDLRTLQRLYRTHVDAPPVELPVL
YTYSIISAAAGSPTADWQAKVEWLEARGYPLARMACEVAAAKPDALPRLQWLRQRGYPFD
VFVAECAAGAGNVEALQYVLSQGGEVGELTTRRAVQGGHVAVMEVLHARGVPMGEEVVMT
AAAAGHLPAVAWLVERLGAGAALTAHVFAAAAQAGSMELLAWLREKGCPWDAMVFAAAAE
GGSEEQLEWLAEQGCPMGDDGAPYAHAAANGELAILRCLRRLSCPWSPDGGTFTRAVGLS
WARNTGQHAERGLCWLLDRGCPVDWDERANKRQRSQSPASPPQQQLAAATSDPPRIWLPE
LVQRFAVSLTSNEVACTLRLVNKATAAQFSTPQHTTVRLSQPVPHHAFVRRWAGPDAMRT
LARRQRFELSRLTARSGSIANLEVLLARDDLPLSLNPRVFMAAAAAGQLDVCVWLRQQAC
PRPVGLLAAAAEGGHRAVCEWVLANGYYNGHARITQGGRLLLLQGVATWTSWTGCCCTRM
APVWPQWPRRLHHPHVGTLPGGPPAAFKPGLISTAAGSPTADWQAKVEWLEARGYPQARI
ACEVAAAQPDALPRLQWLRQRGYPFNAYVADSAAGAGNMEALQYVLGQGGEVDGRAMQCA
AQGGHVAVMEVLHARGVLMGEEGVRRAAKAGHLPAVAWLVERLGAGTALTTHVFAAAAQA
GSMELLAWLRERGCPWDATVFDAAAEEGSEEQLEWLAEQGCPMGVDGAPYARAAASGELA
ILRCLRRLSCLWSLDGGTFTRAVGFLRTTRIRQHVERGLCWLLEQGCPVDWDEAELAAAG
NEVLKRWVHARR
Download sequence
Identical sequences A0A2J7ZYZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]