SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8IQ46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8IQ46
Domain Number 1 Region: 118-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-33
Family cAMP-binding domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.23e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00028
Further Details:      
 
Domain Number 3 Region: 243-296
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000903
Family cAMP-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8IQ46
Sequence length 297
Comment (tr|A0A2J8IQ46|A0A2J8IQ46_PANTR) PRKAR1B isoform 8 {ECO:0000313|EMBL:PNI12648.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0054175 OC=Catarrhini; Hominidae; Pan.
Sequence
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVIDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITE
Download sequence
Identical sequences A0A2J8IQ46 A0A2J8SR41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]