SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8J4I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8J4I0
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-43
Family RUN domain 0.0000553
Further Details:      
 
Weak hits

Sequence:  A0A2J8J4I0
Domain Number - Region: 250-318
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0562
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8J4I0
Sequence length 405
Comment (tr|A0A2J8J4I0|A0A2J8J4I0_PANTR) RUNDC3A isoform 4 {ECO:0000313|EMBL:PNI17677.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0050748 OC=Catarrhini; Hominidae; Pan.
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENIST
ARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAI
DFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPL
VTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
QREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSK
LYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
Download sequence
Identical sequences A0A2J8J4I0 A0A2K5NT80 A0A2K5Z192 A0A2K6B3M8
ENSP00000225441 gi|5730015|ref|NP_006686.1| GO.36609 O60651 NP_006686.1.87134 NP_006686.1.92137 XP_008010619.1.81039 XP_011717963.1.29376 XP_011841300.1.47321 XP_011914122.1.92194 XP_014975348.1.72884 XP_016787149.1.37143 ENSP00000225441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]