SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8J7X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8J7X2
Domain Number 1 Region: 269-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.76e-34
Family Pentraxin (pentaxin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8J7X2
Sequence length 478
Comment (tr|A0A2J8J7X2|A0A2J8J7X2_PANTR) PTX4 isoform 2 {ECO:0000313|EMBL:PNI18871.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0049878 OC=Catarrhini; Hominidae; Pan.
Sequence
MGCSWRKTSSFFLVFVPIYLHGASSQEAAPVGPRKPFFERLRRLEEQFRRFQEVTWTHLQ
SIASNYNVSYNVDVRFRSLAEESQAVAQAVNRSQASVQGELAQLKAWVRKMQRRGRKVDT
RLRALDLTLGERSQQRARERKAHKAQRDALQDSLACLEGLIHSQGARLAALEGRLPVAHP
GTAALGPALVPTPTQPEELSPTSLKLQRDRQELRAASEHGGPPQDSSAPLQGRREPPASG
SHRVLSGTAPKDPRQQAWSPQEPGEICGVGPTLVFPNASTKNVVFLSPGFVTALRALSFC
SWVRMASGRLGTLLSYATEDNDNKLVLHGRDSLLPGSIHFVIGDPAFRELPLQLLLDGQW
HHICVIWTSTQGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAF
VGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQRANCTCLERCP
Download sequence
Identical sequences A0A2J8J7X2
ENSPTRP00000061091 ENSPTRP00000061091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]