SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8JHA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8JHA8
Domain Number - Region: 23-102
Classification Level Classification E-value
Superfamily GAF domain-like 0.0628
Family GAF domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8JHA8
Sequence length 174
Comment (tr|A0A2J8JHA8|A0A2J8JHA8_PANTR) PTCH1 isoform 15 {ECO:0000313|EMBL:PNI22156.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0047662 OC=Catarrhini; Hominidae; Pan.
Sequence
MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELIT
ETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKI
NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNG
Download sequence
Identical sequences A0A0C4DGI4 A0A2J8JHA8
ENSP00000447008 ENSP00000447797 ENSP00000447878 ENSP00000448843 ENSP00000447008 ENSP00000447797 ENSP00000447878 ENSP00000448843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]