SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8JHW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8JHW1
Sequence length 92
Comment (tr|A0A2J8JHW1|A0A2J8JHW1_PANTR) NDRG2 isoform 75 {ECO:0000313|EMBL:PNI22360.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0047340 OC=Catarrhini; Hominidae; Pan.
Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLN
YKSCFQPLFQFEDMQEIIQNFVRVHVDAPGME
Download sequence
Identical sequences A0A2J8JHW1 A0A2J8TSR2 G3V239
ENSP00000450450 ENSP00000450450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]