SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8JLJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8JLJ3
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Weak hits

Sequence:  A0A2J8JLJ3
Domain Number - Region: 131-179
Classification Level Classification E-value
Superfamily RNI-like 0.0746
Family Rna1p (RanGAP1), N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8JLJ3
Sequence length 247
Comment (tr|A0A2J8JLJ3|A0A2J8JLJ3_PANTR) ZNF471 isoform 2 {ECO:0000313|EMBL:PNI23643.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0046282 OC=Catarrhini; Hominidae; Pan.
Sequence
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSLVSLGLCISKP
YVISLLEQGREPWEMTSEMTRSPFSEFILVKNHMHVRNVEKPSSKGNTLLNITEHILERN
SLNVKNVGKPSNKVNTLFSIKEFILEKNHINVRNAEKPSDSLHTLLSIREFILERNPMNV
KNVAKPSVMARLLLDIRDVTLAKDPMNVLSVGRLLGITHLLFVTGGVIILERSLLIALIV
GKPSVFT
Download sequence
Identical sequences A0A2J8JLJ3
ENSP00000466224 ENSP00000466224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]