SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8K544 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8K544
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00123
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8K544
Sequence length 147
Comment (tr|A0A2J8K544|A0A2J8K544_PANTR) SSR2 isoform 14 {ECO:0000313|EMBL:PNI30122.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0041289 OC=Catarrhini; Hominidae; Pan.
Sequence
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHF
Download sequence
Identical sequences A0A2J8K544 A0A2J8VGN9 E9PQI4
ENSP00000436228 ENSP00000436228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]