SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8K7C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8K7C0
Domain Number 1 Region: 9-72
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000000209
Family Rhomboid-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8K7C0
Sequence length 86
Comment (tr|A0A2J8K7C0|A0A2J8K7C0_PANTR) RHBDF2 isoform 6 {ECO:0000313|EMBL:PNI30927.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0040893 OC=Catarrhini; Hominidae; Pan.
Sequence
LPFLNPEVPDQFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGI
TGNLASAIFLPYRAEPQGSPCLPGRS
Download sequence
Identical sequences A0A2J8K7C0 K7EPN8
ENSP00000467468 ENSP00000467468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]