SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8KN69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8KN69
Domain Number 1 Region: 218-483
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-77
Family Protein kinases, catalytic subunit 0.000000202
Further Details:      
 
Domain Number 2 Region: 115-249
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-34
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 3 Region: 36-164
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000683
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8KN69
Sequence length 489
Comment (tr|A0A2J8KN69|A0A2J8KN69_PANTR) SRMS isoform 1 {ECO:0000313|EMBL:PNI36454.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0037287 OC=Catarrhini; Hominidae; Pan.
Sequence
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALY
DFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPW
YFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
VTELMRKGNLQAFLGSPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDD
GLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLYEVF
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
HAIHRCHPR
Download sequence
Identical sequences A0A2J8KN69
9598.ENSPTRP00000023666 ENSPTRP00000023666 ENSPTRP00000023666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]