SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8L7I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8L7I7
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-58
Family Ankyrin repeat 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8L7I7
Sequence length 274
Comment (tr|A0A2J8L7I7|A0A2J8L7I7_PANTR) ASB7 isoform 3 {ECO:0000313|EMBL:PNI43239.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0031979 OC=Catarrhini; Hominidae; Pan.
Sequence
MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKE
RCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQN
GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCARMLYNYGADT
NTRNYEGQTPLAVSISISGSSRPCLDFLQEVTSM
Download sequence
Identical sequences A0A024RCD9 A0A061IAP8 A0A2J8L7I7 A0A2J8VXT1
gi|30089994|ref|NP_078984.2| NP_078984.2.87134 NP_078984.2.92137 XP_012419638.1.74151 ENSP00000339819 ENSP00000339819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]