SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8LAM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8LAM1
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000179
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8LAM1
Sequence length 152
Comment (tr|A0A2J8LAM1|A0A2J8LAM1_PANTR) UBALD1 isoform 8 {ECO:0000313|EMBL:PNI44311.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0031278 OC=Catarrhini; Hominidae; Pan.
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQ
MASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWT
PTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Download sequence
Identical sequences A0A2J8LAM1 K7EM88
ENSP00000466404 XP_016878426.1.92137 ENSP00000466404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]