SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8LXV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8LXV9
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.96e-20
Family Nucleoplasmin-like core domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8LXV9
Sequence length 111
Comment (tr|A0A2J8LXV9|A0A2J8LXV9_PANTR) NPM1 isoform 8 {ECO:0000313|EMBL:PNI52110.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0025770 OC=Catarrhini; Hominidae; Pan.
Sequence
MNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAE
SEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDED
Download sequence
Identical sequences A0A2J8LXV9 E5RI98
ENSP00000429485 ENSP00000429485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]