SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8M246 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8M246
Domain Number - Region: 171-227
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0212
Family N-terminal domain of adrenodoxin reductase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8M246
Sequence length 238
Comment (tr|A0A2J8M246|A0A2J8M246_PANTR) INSIG2 isoform 4 {ECO:0000313|EMBL:PNI53559.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0024320 OC=Catarrhini; Hominidae; Pan.
Sequence
MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP
DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY
TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAENLIRNEEGKKYLLYRKAR
Download sequence
Identical sequences A0A0C4DGZ4 A0A2J8M246
ENSP00000484179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]