SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8M2G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8M2G1
Domain Number 1 Region: 4-59
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000214
Family GABA-aminotransferase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8M2G1
Sequence length 60
Comment (tr|A0A2J8M2G1|A0A2J8M2G1_PANTR) ETNPPL isoform 9 {ECO:0000313|EMBL:PNI53706.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0024105 OC=Catarrhini; Hominidae; Pan.
Sequence
MELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVI
Download sequence
Identical sequences A0A2J8M2G1 D6RGG2
ENSP00000421217 ENSP00000421217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]